Lineage for d3qu6b_ (3qu6 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693544Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
    Pfam PF00605
  6. 2693571Protein automated matches [191301] (1 species)
    not a true protein
  7. 2693572Species Human (Homo sapiens) [TaxId:9606] [189980] (1 PDB entry)
  8. 2693574Domain d3qu6b_: 3qu6 B: [184630]
    automated match to d1t2ka_
    complexed with cl, na, zn

Details for d3qu6b_

PDB Entry: 3qu6 (more details), 2.3 Å

PDB Description: Crystal structure of IRF-3 DBD free form
PDB Compounds: (B:) IRF3 protein

SCOPe Domain Sequences for d3qu6b_:

Sequence, based on SEQRES records: (download)

>d3qu6b_ a.4.5.23 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatgay
vpgrdkpdlptwkrnfrsamnrkeglrlaedrskdphdphkiyefv

Sequence, based on observed residues (ATOM records): (download)

>d3qu6b_ a.4.5.23 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkhedfgifqawaeatgayvpgrdkpd
lptwkrnfrsamnrkeglrlaedrskdphdphkiyefv

SCOPe Domain Coordinates for d3qu6b_:

Click to download the PDB-style file with coordinates for d3qu6b_.
(The format of our PDB-style files is described here.)

Timeline for d3qu6b_: