Lineage for d3qo2a1 (3qo2 A:55-114)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055542Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2055722Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2055723Protein automated matches [191139] (4 species)
    not a true protein
  7. 2055733Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries)
  8. 2055744Domain d3qo2a1: 3qo2 A:55-114 [184543]
    Other proteins in same PDB: d3qo2a2
    automated match to d2dnta1
    protein/DNA complex; complexed with edo

Details for d3qo2a1

PDB Entry: 3qo2 (more details), 2.49 Å

PDB Description: structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
PDB Compounds: (A:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3qo2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qo2a1 b.34.13.0 (A:55-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk

SCOPe Domain Coordinates for d3qo2a1:

Click to download the PDB-style file with coordinates for d3qo2a1.
(The format of our PDB-style files is described here.)

Timeline for d3qo2a1: