Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
Protein automated matches [191139] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries) |
Domain d3qo2c_: 3qo2 C: [184545] Other proteins in same PDB: d3qo2a2 automated match to d2dnta1 protein/DNA complex; complexed with edo |
PDB Entry: 3qo2 (more details), 2.49 Å
SCOPe Domain Sequences for d3qo2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qo2c_ b.34.13.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} edvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
Timeline for d3qo2c_:
View in 3D Domains from other chains: (mouse over for more information) d3qo2a1, d3qo2a2, d3qo2b_, d3qo2d_ |