Lineage for d3qlwb_ (3qlw B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511367Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 2511397Domain d3qlwb_: 3qlw B: [184481]
    automated match to d1ai9a_
    complexed with n22, ndp

Details for d3qlwb_

PDB Entry: 3qlw (more details), 2.5 Å

PDB Description: Candida albicans dihydrofolate reductase complexed with NADPH and 5-[3-(2,5-dimethoxyphenyl)prop-1-yn-1-yl]-6-ethylpyrimidine-2,4-diamine (UCP120B)
PDB Compounds: (B:) Putative uncharacterized protein CaJ7.0360

SCOPe Domain Sequences for d3qlwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qlwb_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
kpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesi
pqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyneli
nnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdf
tynytlwtrk

SCOPe Domain Coordinates for d3qlwb_:

Click to download the PDB-style file with coordinates for d3qlwb_.
(The format of our PDB-style files is described here.)

Timeline for d3qlwb_: