SCOP 1.67: Domain d1hw2a2: 1hw2 A:79-228

Lineage for d1hw2a2 (1hw2 A:79-228)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.78: Fatty acid responsive transcription factor FadR, C-terminal domain [48007] (1 superfamily)
   core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.78.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48008] (1 family)

5. Family a.78.1.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48009] (1 protein)

6. Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)

7. Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)

8. Domain d1hw2a2: 1hw2 A:79-228 [18444]
   Other proteins in same PDB: d1hw2a1, d1hw2b1

Details for d1hw2a2

PDB Entry: 1hw2, 3.25 Å

PDB Description: fadr-dna complex: transcriptional control of fatty acid metabolism in echerichia coli

SCOP Domain Sequences for d1hw2a2:

Sequence; same for both SEQRES and ATOM records:

>d1hw2a2 a.78.1.1 (A:79-228) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmqk

Timeline for d1hw2a2:

• d1hw2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1hw2a2 appears in SCOP 1.65
  
• d1hw2a2 appears in SCOP 1.69
  
• d1hw2a2 appears in the current release, SCOPe 2.08