Lineage for d1hw2a2 (1hw2 A:79-228)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5012Fold a.78: Fatty acid responsive transcription factor FadR, C-terminal domain [48007] (1 superfamily)
  4. 5013Superfamily a.78.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48008] (1 family) (S)
  5. 5014Family a.78.1.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48009] (1 protein)
  6. 5015Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)
  7. 5016Species Escherichia coli [TaxId:562] [48011] (3 PDB entries)
  8. 5020Domain d1hw2a2: 1hw2 A:79-228 [18444]
    Other proteins in same PDB: d1hw2a1, d1hw2b1

Details for d1hw2a2

PDB Entry: 1hw2 (more details), 3.25 Å

PDB Description: fadr-dna complex: transcriptional control of fatty acid metabolism in echerichia coli

SCOP Domain Sequences for d1hw2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw2a2 a.78.1.1 (A:79-228) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmqk

SCOP Domain Coordinates for d1hw2a2:

Click to download the PDB-style file with coordinates for d1hw2a2.
(The format of our PDB-style files is described here.)

Timeline for d1hw2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hw2a1