SCOPe 2.01: Domain d3qhra_: 3qhr A:

Lineage for d3qhra_ (3qhr A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (204 PDB entries)
   Uniprot P24941

8. Domain d3qhra_: 3qhr A: [184384]
   automated match to d1ogua_
   complexed with adp, cl, gol, mg, mgf

Details for d3qhra_

PDB Entry: 3qhr, 2.17 Å

PDB Description: Structure of a pCDK2/CyclinA transition-state mimic

PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d3qhra_:

Sequence; same for both SEQRES and ATOM records:

>d3qhra_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
ghmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d3qhra_:

• d3qhra_ is new in SCOPe 2.01-stable
  
• d3qhra_ appears in SCOPe 2.02
  
• d3qhra_ appears in the current release, SCOPe 2.08, called d3qhra1