SCOP 1.65: Domain d3ygsp_: 3ygs P:

Lineage for d3ygsp_ (3ygs P:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (3 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (4 proteins)

6. Protein Procaspase 9 prodomain [47999] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48000] (1 PDB entry)

8. Domain d3ygsp_: 3ygs P: [18435]
   Other proteins in same PDB: d3ygsc_

Details for d3ygsp_

PDB Entry: 3ygs, 2.5 Å

PDB Description: apaf-1 card in complex with prodomain of procaspase-9

SCOP Domain Sequences for d3ygsp_:

Sequence; same for both SEQRES and ATOM records:

>d3ygsp_ a.77.1.3 (P:) Procaspase 9 prodomain {Human (Homo sapiens)}
smdeadrrllrrcrlrlveelqvdqlwdvllsrelfrphmiediqragsgsrrdqarqli
idletrgsqalplfiscledtgqdmlasflrtnrqag

Timeline for d3ygsp_:

• d3ygsp_ first appeared (with stable ids) in SCOP 1.55
  
• d3ygsp_ appears in SCOP 1.63
  
• d3ygsp_ appears in SCOP 1.67
  
• d3ygsp_ appears in the current release, SCOPe 2.08, called d3ygsp1