PDB entry 3ygs

View 3ygs on RCSB PDB site
Description: apaf-1 card in complex with prodomain of procaspase-9
Deposited on 1999-05-08, released 2000-04-19
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-19, with a file datestamp of 2000-04-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.65: d3ygsc_
  • Chain 'P':
    Domains in SCOP 1.65: d3ygsp_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ygsC (C:)
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvvs

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ygsP (P:)
smdeadrrllrrcrlrlveelqvdqlwdvllsrelfrphmiediqragsgsrrdqarqli
idletrgsqalplfiscledtgqdmlasflrtnrqag