SCOPe 2.08: Domain d3ygsp1: 3ygs P:2-97

Lineage for d3ygsp1 (3ygs P:2-97)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)

6. Protein Procaspase 9 prodomain [47999] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48000] (1 PDB entry)

8. Domain d3ygsp1: 3ygs P:2-97 [18435]
   Other proteins in same PDB: d3ygsc_, d3ygsp2

Details for d3ygsp1

PDB Entry: 3ygs, 2.5 Å

PDB Description: apaf-1 card in complex with prodomain of procaspase-9

PDB Compounds: (P:) procaspase 9

SCOPe Domain Sequences for d3ygsp1:

Sequence; same for both SEQRES and ATOM records:

>d3ygsp1 a.77.1.3 (P:2-97) Procaspase 9 prodomain {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdvllsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqag

Timeline for d3ygsp1:

• d3ygsp1 first appeared (with stable ids) in SCOP 1.55, called d3ygsp_
  
• d3ygsp1 appears in SCOPe 2.07