SCOPe 2.04: Domain d3qc3b_: 3qc3 B:

Lineage for d3qc3b_ (3qc3 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189658] (4 PDB entries)

8. Domain d3qc3b_: 3qc3 B: [184334]
   automated match to d1h1ya_
   complexed with fe, gol, ni, zn

Details for d3qc3b_

PDB Entry: 3qc3, 2.2 Å

PDB Description: crystal structure of a d-ribulose-5-phosphate-3-epimerase (np_954699) from homo sapiens at 2.20 a resolution

PDB Compounds: (B:) D-ribulose-5-phosphate-3-epimerase

SCOPe Domain Sequences for d3qc3b_:

Sequence; same for both SEQRES and ATOM records:

>d3qc3b_ c.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmasgckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrk
qlgqdpffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglai
kpgtsveylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvg
pdtvhkcaeaganmivsgsaimrsedprsvinllrnvcseaaqkr

Timeline for d3qc3b_:

• d3qc3b_ first appeared in SCOPe 2.01
  
• d3qc3b_ appears in SCOPe 2.03
  
• d3qc3b_ appears in SCOPe 2.05
  
• d3qc3b_ appears in the current release, SCOPe 2.08, called d3qc3b1