Lineage for d3qbyb_ (3qby B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537450Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 1537470Protein automated matches [190966] (1 species)
    not a true protein
  7. 1537471Species Human (Homo sapiens) [TaxId:9606] [188600] (7 PDB entries)
  8. 1537473Domain d3qbyb_: 3qby B: [184331]
    automated match to d1n27a_
    complexed with so4, unx

Details for d3qbyb_

PDB Entry: 3qby (more details), 1.95 Å

PDB Description: crystal structure of the pwwp domain of human hepatoma-derived growth factor 2
PDB Compounds: (B:) Hepatoma-derived growth factor-related protein 2

SCOPe Domain Sequences for d3qbyb_:

Sequence, based on SEQRES records: (download)

>d3qbyb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afkpgdlvfakmkgyphwpariddiadgavkpppnkypifffgthetaflgpkdlfpydk
ckdkygkpnkrkgfneglweiqnnphasys

Sequence, based on observed residues (ATOM records): (download)

>d3qbyb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afkpgdlvfakmkgyphwpariddpppnkypifffgthetaflgpkdlfpydkckdkygk
pnkrkgfneglweiqnnphasys

SCOPe Domain Coordinates for d3qbyb_:

Click to download the PDB-style file with coordinates for d3qbyb_.
(The format of our PDB-style files is described here.)

Timeline for d3qbyb_: