Lineage for d3q7za_ (3q7z A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1055048Species Staphylococcus aureus [TaxId:1280] [189852] (2 PDB entries)
  8. 1055049Domain d3q7za_: 3q7z A: [184268]
    automated match to d1xa1c_
    complexed with bou

Details for d3q7za_

PDB Entry: 3q7z (more details), 1.87 Å

PDB Description: cbap-acylated blar1 sensor domain from staphylococcus aureus
PDB Compounds: (A:) Beta-lactamase regulatory protein BlaR1

SCOPe Domain Sequences for d3q7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7za_ e.3.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
sekilkemgvln

SCOPe Domain Coordinates for d3q7za_:

Click to download the PDB-style file with coordinates for d3q7za_.
(The format of our PDB-style files is described here.)

Timeline for d3q7za_: