SCOPe 2.07: Domain d3q6sb_: 3q6s B:

Lineage for d3q6sb_ (3q6s B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Heterochromatin protein 1, HP1 [54166] (4 species)
   duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain

7. Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries)

8. Domain d3q6sb_: 3q6s B: [184232]
   automated match to d1s4za_

Details for d3q6sb_

PDB Entry: 3q6s, 1.93 Å

PDB Description: The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from Shugoshin 1

PDB Compounds: (B:) chromobox protein homolog 1

SCOPe Domain Sequences for d3q6sb_:

Sequence; same for both SEQRES and ATOM records:

>d3q6sb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
twhsyps

Timeline for d3q6sb_:

• d3q6sb_ first appeared in SCOPe 2.01
  
• d3q6sb_ appears in SCOPe 2.06
  
• d3q6sb_ appears in the current release, SCOPe 2.08