Lineage for d3q6sb_ (3q6s B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785124Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 2785132Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries)
  8. 2785139Domain d3q6sb_: 3q6s B: [184232]
    automated match to d1s4za_

Details for d3q6sb_

PDB Entry: 3q6s (more details), 1.93 Å

PDB Description: The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from Shugoshin 1
PDB Compounds: (B:) chromobox protein homolog 1

SCOPe Domain Sequences for d3q6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6sb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
twhsyps

SCOPe Domain Coordinates for d3q6sb_:

Click to download the PDB-style file with coordinates for d3q6sb_.
(The format of our PDB-style files is described here.)

Timeline for d3q6sb_: