| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
| Protein Heterochromatin protein 1, HP1 [54166] (4 species) duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain |
| Species Human (Homo sapiens) [TaxId:9606] [187099] (3 PDB entries) |
| Domain d3q6sb_: 3q6s B: [184232] automated match to d1s4za_ |
PDB Entry: 3q6s (more details), 1.93 Å
SCOPe Domain Sequences for d3q6sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q6sb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Human (Homo sapiens) [TaxId: 9606]}
kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
twhsyps
Timeline for d3q6sb_: