Lineage for d3q5ha_ (3q5h A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1131149Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1131451Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 1131459Species Human (Homo sapiens) [TaxId:9606] [50669] (42 PDB entries)
  8. 1131488Domain d3q5ha_: 3q5h A: [184221]
    automated match to d1bila_
    complexed with cl, rx6

Details for d3q5ha_

PDB Entry: 3q5h (more details), 2.16 Å

PDB Description: clinically useful alkyl amine renin inhibitors
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d3q5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q5ha_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d3q5ha_:

Click to download the PDB-style file with coordinates for d3q5ha_.
(The format of our PDB-style files is described here.)

Timeline for d3q5ha_: