SCOPe 2.07: Domain d3q5fb_: 3q5f B:

Lineage for d3q5fb_ (3q5f B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Transcriptional regulator SlyA [81688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [158271] (3 PDB entries)
   Uniprot P40676 1-140

8. Domain d3q5fb_: 3q5f B: [184219]
   automated match to d3deua1
   protein/DNA complex

Details for d3q5fb_

PDB Entry: 3q5f, 2.96 Å

PDB Description: crystal structure of the salmonella transcriptional regulator slya in complex with dna

PDB Compounds: (B:) Transcriptional regulator slyA

SCOPe Domain Sequences for d3q5fb_:

Sequence; same for both SEQRES and ATOM records:

>d3q5fb_ a.4.5.28 (B:) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]}
splgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqps
lvrtldqledkglisrqtcasdrrakrikltekaepliaemeevihktrgeilagissee
iellikliaklehnimelhs

Timeline for d3q5fb_:

• d3q5fb_ first appeared in SCOPe 2.01
  
• d3q5fb_ appears in SCOPe 2.06
  
• d3q5fb_ appears in the current release, SCOPe 2.08