Lineage for d3q5fb_ (3q5f B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693803Protein Transcriptional regulator SlyA [81688] (2 species)
  7. 2693807Species Salmonella typhimurium [TaxId:90371] [158271] (3 PDB entries)
    Uniprot P40676 1-140
  8. 2693812Domain d3q5fb_: 3q5f B: [184219]
    automated match to d3deua1
    protein/DNA complex

Details for d3q5fb_

PDB Entry: 3q5f (more details), 2.96 Å

PDB Description: crystal structure of the salmonella transcriptional regulator slya in complex with dna
PDB Compounds: (B:) Transcriptional regulator slyA

SCOPe Domain Sequences for d3q5fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q5fb_ a.4.5.28 (B:) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]}
splgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqps
lvrtldqledkglisrqtcasdrrakrikltekaepliaemeevihktrgeilagissee
iellikliaklehnimelhs

SCOPe Domain Coordinates for d3q5fb_:

Click to download the PDB-style file with coordinates for d3q5fb_.
(The format of our PDB-style files is described here.)

Timeline for d3q5fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3q5fa_