SCOPe 2.01: Domain d3q3ya_: 3q3y A:

Lineage for d3q3ya_ (3q3y A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (9 species)

7. Species Human enterovirus b [TaxId:138949] [189732] (3 PDB entries)

8. Domain d3q3ya_: 3q3y A: [184202]
   automated match to d1l1na_
   complexed with edo, nh4, pi, xnv

Details for d3q3ya_

PDB Entry: 3q3y, 1.32 Å

PDB Description: Complex structure of HEVB EV93 main protease 3C with Compound 1 (AG7404)

PDB Compounds: (A:) HEVB EV93 3C protease

SCOPe Domain Sequences for d3q3ya_:

Sequence; same for both SEQRES and ATOM records:

>d3q3ya_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human enterovirus b [TaxId: 138949]}
kgpafefavammkrnastvkteygeftmlgiydrwavlprhakpgptilmndqevgvlda
kelvdkdgtnleltllklnrnekfrdirgflareevevneavlaintskfpnmyipvgqv
tdygflnlggtptkrmlvynfptragqcggvlmstgkvlgihvggnghqgfsaallrhyf
n

Timeline for d3q3ya_:

• d3q3ya_ is new in SCOPe 2.01-stable
  
• d3q3ya_ appears in SCOPe 2.02
  
• d3q3ya_ appears in the current release, SCOPe 2.08, called d3q3ya1