![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily) consists of two non-similar domains, 3 layers (a/b/a) each Domain 1 has parallel beta-sheet of 6 strands, order 342156 Domain 2 has parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) ![]() |
![]() | Family c.86.1.0: automated matches [191414] (1 protein) not a true family |
![]() | Protein automated matches [190573] (2 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:192222] [189604] (1 PDB entry) |
![]() | Domain d3q3va_: 3q3v A: [184199] automated match to d1vpea_ complexed with fmt, k, pge, so4 |
PDB Entry: 3q3v (more details), 2.15 Å
SCOPe Domain Sequences for d3q3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3va_ c.86.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]} diisikdidlakkkvfircdfnvpqddflnitddrrirsaiptirycldngcsvilashl grpkeisskyslepvakrlarlldkeivmakdvigedaktkamnlkageilllenlrfek getkndenlakelasmvqvyindafgvchrahssveaitkffdekhkgagfllqkeidfa snlikhparpfvavvggskvsgklqaltnllpkvdkliigggmaftflkalgydignsll eeelleeankiltkgknlgvkiylpvdvvaapacsqdvpmkfvpaqeipngwmgldigpa svrlfkevisdaqtiwwngpmgvfeidkfskgsikmshyiseghatsvvgggdtadvvar agdademtfistgggasleliegkelpgvkalrs
Timeline for d3q3va_: