Lineage for d3q3va_ (3q3v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910394Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2910395Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2910481Family c.86.1.0: automated matches [191414] (1 protein)
    not a true family
  6. 2910482Protein automated matches [190573] (6 species)
    not a true protein
  7. 2910490Species Campylobacter jejuni [TaxId:192222] [189604] (1 PDB entry)
  8. 2910491Domain d3q3va_: 3q3v A: [184199]
    automated match to d1vpea_
    complexed with fmt, k, pge, so4

Details for d3q3va_

PDB Entry: 3q3v (more details), 2.15 Å

PDB Description: crystal structure of phosphoglycerate kinase from campylobacter jejuni.
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d3q3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3va_ c.86.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
diisikdidlakkkvfircdfnvpqddflnitddrrirsaiptirycldngcsvilashl
grpkeisskyslepvakrlarlldkeivmakdvigedaktkamnlkageilllenlrfek
getkndenlakelasmvqvyindafgvchrahssveaitkffdekhkgagfllqkeidfa
snlikhparpfvavvggskvsgklqaltnllpkvdkliigggmaftflkalgydignsll
eeelleeankiltkgknlgvkiylpvdvvaapacsqdvpmkfvpaqeipngwmgldigpa
svrlfkevisdaqtiwwngpmgvfeidkfskgsikmshyiseghatsvvgggdtadvvar
agdademtfistgggasleliegkelpgvkalrs

SCOPe Domain Coordinates for d3q3va_:

Click to download the PDB-style file with coordinates for d3q3va_.
(The format of our PDB-style files is described here.)

Timeline for d3q3va_: