SCOPe 2.04: Domain d3q0ra_: 3q0r A:

Lineage for d3q0ra_ (3q0r A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
   this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain

6. Protein automated matches [191057] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189670] (4 PDB entries)

8. Domain d3q0ra_: 3q0r A: [184131]
   automated match to d1m8yb_
   protein/RNA complex

Details for d3q0ra_

PDB Entry: 3q0r, 2 Å

PDB Description: Crystal structure of the PUMILIO-homology domain from Human PUMILIO2 in complex with p38alpha NREb

PDB Compounds: (A:) Pumilio homolog 2

SCOPe Domain Sequences for d3q0ra_:

Sequence; same for both SEQRES and ATOM records:

>d3q0ra_ a.118.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrfpnlqlrdlighivefsqdqhgsrfiqqkleratpaerqmvfneilq
aayqlmtdvfgnyviqkffefgsldqklalatrirghvlplalqmygcrviqkalesiss
dqqvisemvkeldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfvlsthpy
gcrviqrilehctaeqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivsei
rgkvlalsqhkfasnvvekcvthasraerallidevccqndgphsalytmmkdqyanyvv
qkmidmaepaqrkiimhkirphittlrkytygkhilaklekyy

Timeline for d3q0ra_:

• d3q0ra_ first appeared in SCOPe 2.01
  
• d3q0ra_ appears in SCOPe 2.03
  
• d3q0ra_ appears in SCOPe 2.05
  
• d3q0ra_ appears in the current release, SCOPe 2.08