Lineage for d3pyya1 (3pyy A:265-519)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983389Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)
  8. 2983830Domain d3pyya1: 3pyy A:265-519 [184086]
    Other proteins in same PDB: d3pyya2, d3pyyb2
    automated match to d1opjb_
    complexed with 2pe, 3yy, gol, so4, sti

Details for d3pyya1

PDB Entry: 3pyy (more details), 1.85 Å

PDB Description: discovery and characterization of a cell-permeable, small-molecule c- abl kinase activator that binds to the myristoyl binding site
PDB Compounds: (A:) V-abl Abelson murine leukemia viral oncogene homolog 1 isoform b variant

SCOPe Domain Sequences for d3pyya1:

Sequence, based on SEQRES records: (download)

>d3pyya1 d.144.1.7 (A:265-519) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc
treppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla
arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf
gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps
faeihqafetmfqes

Sequence, based on observed residues (ATOM records): (download)

>d3pyya1 d.144.1.7 (A:265-519) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlkeveeflkeaavmkeikhpnlvqllgvctrep
pfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdlaarnc
lvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvll
weiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaei
hqafetmfqes

SCOPe Domain Coordinates for d3pyya1:

Click to download the PDB-style file with coordinates for d3pyya1.
(The format of our PDB-style files is described here.)

Timeline for d3pyya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pyya2