SCOPe 2.01: Domain d3pyya_: 3pyy A:

Lineage for d3pyya_ (3pyy A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries)

8. Domain d3pyya_: 3pyy A: [184086]
   automated match to d1opjb_
   complexed with 2pe, 3yy, gol, so4, sti

Details for d3pyya_

PDB Entry: 3pyy, 1.85 Å

PDB Description: discovery and characterization of a cell-permeable, small-molecule c- abl kinase activator that binds to the myristoyl binding site

PDB Compounds: (A:) V-abl Abelson murine leukemia viral oncogene homolog 1 isoform b variant

SCOPe Domain Sequences for d3pyya_:

Sequence, based on SEQRES records:

>d3pyya_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqes

Sequence, based on observed residues (ATOM records):

>d3pyya_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydkwemertditmkhklgggqygevyegvwkkysltvavktlkeveeflkeaavmkeikh
pnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyle
kknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynk
fsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmrac
wqwnpsdrpsfaeihqafetmfqes

Timeline for d3pyya_:

• d3pyya_ is new in SCOPe 2.01-stable
  
• d3pyya_ appears in SCOPe 2.02
  
• d3pyya_ appears in the current release, SCOPe 2.08, called d3pyya1