SCOP 1.67: Domain d2tdx_2: 2tdx 65-139

Lineage for d2tdx_2 (2tdx 65-139)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries)

8. Domain d2tdx_2: 2tdx 65-139 [18407]
   Other proteins in same PDB: d2tdx_1
   complexed with ni; mutant

Details for d2tdx_2

PDB Entry: 2tdx, 2.4 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel

SCOP Domain Sequences for d2tdx_2:

Sequence; same for both SEQRES and ATOM records:

>d2tdx_2 a.76.1.1 (65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg

Timeline for d2tdx_2:

• d2tdx_2 first appeared (with stable ids) in SCOP 1.55
  
• d2tdx_2 appears in SCOP 1.65
  
• d2tdx_2 appears in SCOP 1.69
  
• d2tdx_2 appears in the current release, SCOPe 2.08, called d2tdxa2