| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
| Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
| Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
| Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries) Uniprot P33120 |
| Domain d2tdxa2: 2tdx A:65-139 [18407] Other proteins in same PDB: d2tdxa1 protein/DNA complex; complexed with ni; mutant |
PDB Entry: 2tdx (more details), 2.4 Å
SCOPe Domain Sequences for d2tdxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tdxa2 a.76.1.1 (A:65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg
Timeline for d2tdxa2: