Lineage for d2dtra2 (2dtr A:65-140)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918737Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 918738Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 918739Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 918740Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 918741Species Corynebacterium diphtheriae [TaxId:1717] [47982] (17 PDB entries)
    Uniprot P33120
  8. 918742Domain d2dtra2: 2dtr A:65-140 [18399]
    Other proteins in same PDB: d2dtra1, d2dtra3
    complexed with co, so4

Details for d2dtra2

PDB Entry: 2dtr (more details), 1.9 Å

PDB Description: structure of diphtheria toxin repressor
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2dtra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtra2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOPe Domain Coordinates for d2dtra2:

Click to download the PDB-style file with coordinates for d2dtra2.
(The format of our PDB-style files is described here.)

Timeline for d2dtra2: