Lineage for d2dtr_2 (2dtr 65-140)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4941Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)
  4. 4942Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) (S)
  5. 4943Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)
  6. 4944Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 4945Species Corynebacterium diphtheriae [TaxId:1717] [47982] (10 PDB entries)
  8. 4947Domain d2dtr_2: 2dtr 65-140 [18399]
    Other proteins in same PDB: d2dtr_1, d2dtr_3

Details for d2dtr_2

PDB Entry: 2dtr (more details), 2 Å

PDB Description: structure of diphtheria toxin repressor

SCOP Domain Sequences for d2dtr_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtr_2 a.76.1.1 (65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOP Domain Coordinates for d2dtr_2:

Click to download the PDB-style file with coordinates for d2dtr_2.
(The format of our PDB-style files is described here.)

Timeline for d2dtr_2: