Lineage for d2dtr_2 (2dtr 65-140)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily) Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family) 
Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins) Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) Species Corynebacterium diphtheriae [TaxId:1717] [47982] (10 PDB entries) 
Domain d2dtr_2: 2dtr 65-140 [18399]
Other proteins in same PDB: d2dtr_1, d2dtr_3
Details for d2dtr_2
PDB Entry: 2dtr (more details), 2 Å
PDB Description: structure of diphtheria toxin repressor
SCOP Domain Sequences for d2dtr_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtr_2 a.76.1.1 (65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv
SCOP Domain Coordinates for d2dtr_2:
Click to download the PDB-style file with coordinates for d2dtr_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dtr_2:
- d2dtr_2 appears in SCOP 1.57
- d2dtr_2 appears in the current release, SCOPe 2.08, called d2dtra2
View in 3D
