SCOPe 2.07: Domain d1hnxg_: 1hnx G:

Lineage for d1hnxg_ (1hnx G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (4 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
   Uniprot P17291

8. Domain d1hnxg_: 1hnx G: [18398]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
   complexed with mg, pcy, zn

Details for d1hnxg_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1hnxg_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d1hnxg_:

• d1hnxg_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxg_ appears in SCOPe 2.06
  
• d1hnxg_ appears in the current release, SCOPe 2.08