![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
![]() | Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() automatically mapped to Pfam PF00189 |
![]() | Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
![]() | Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
![]() | Domain d1hnxc2: 1hnx C:107-207 [38843] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ complexed with mg, pcy, zn |
PDB Entry: 1hnx (more details), 3.4 Å
SCOPe Domain Sequences for d1hnxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1hnxc2: