Lineage for d1hnxc2 (1hnx C:107-207)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554405Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2554406Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2554407Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2554408Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2554434Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2554449Domain d1hnxc2: 1hnx C:107-207 [38843]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxc2

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1hnxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1hnxc2:

Click to download the PDB-style file with coordinates for d1hnxc2.
(The format of our PDB-style files is described here.)

Timeline for d1hnxc2: