SCOPe 2.02: Domain d3pula_: 3pul A:

Lineage for d3pula_ (3pul A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (32 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries)

8. Domain d3pula_: 3pul A: [183978]
   automated match to d1dhpa_
   complexed with act, gol, lys, so4

Details for d3pula_

PDB Entry: 3pul, 2.3 Å

PDB Description: Crystal structure of the complex of Dhydrodipicolinate synthase from Acinetobacter baumannii with lysine at 2.3A resolution

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3pula_:

Sequence; same for both SEQRES and ATOM records:

>d3pula_ c.1.10.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii

Timeline for d3pula_:

• d3pula_ first appeared in SCOPe 2.01
  
• d3pula_ appears in SCOPe 2.03
  
• d3pula_ appears in the current release, SCOPe 2.08