Lineage for d3pula_ (3pul A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1148735Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1148736Protein automated matches [190115] (32 species)
    not a true protein
  7. 1148737Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries)
  8. 1148748Domain d3pula_: 3pul A: [183978]
    automated match to d1dhpa_
    complexed with act, gol, lys, so4

Details for d3pula_

PDB Entry: 3pul (more details), 2.3 Å

PDB Description: Crystal structure of the complex of Dhydrodipicolinate synthase from Acinetobacter baumannii with lysine at 2.3A resolution
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3pula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pula_ c.1.10.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii

SCOPe Domain Coordinates for d3pula_:

Click to download the PDB-style file with coordinates for d3pula_.
(The format of our PDB-style files is described here.)

Timeline for d3pula_: