| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein) |
| Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (12 PDB entries) |
| Domain d3potc_: 3pot C: [183913] automated match to d1hbmc_ complexed with 06c, com, edo, f43, k, mg, tp7, txz |
PDB Entry: 3pot (more details), 1.2 Å
SCOPe Domain Sequences for d3potc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3potc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfn
Timeline for d3potc_: