| Class b: All beta proteins [48724] (180 folds) |
| Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
| Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
| Protein automated matches [191125] (8 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [189619] (3 PDB entries) |
| Domain d3po8a1: 3po8 A:3-97 [183907] Other proteins in same PDB: d3po8a2 automated match to d2affa1 complexed with po4 |
PDB Entry: 3po8 (more details), 1.5 Å
SCOPe Domain Sequences for d3po8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3po8a1 b.26.1.0 (A:3-97) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalladln
stngttvnnapvqewqladgdvirlghseiivrmh
Timeline for d3po8a1: