![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein) |
![]() | Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47967] (4 PDB entries) |
![]() | Domain d1tfba2: 1tfb A:208-316 [18383] Other proteins in same PDB: d1tfba3 |
PDB Entry: 1tfb (more details)
SCOPe Domain Sequences for d1tfba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfba2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} littgdfmsrfcsnlclpkqvqmaathiarkaveldlvpgrspisvaaaaiymasqasae krtqkeigdiagvadvtirqsyrliyprapdlfptdfkfdtpvdklpql
Timeline for d1tfba2: