SCOPe 2.08: Domain d1tfba2: 1tfb A:208-316

Lineage for d1tfba2 (1tfb A:208-316)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)

6. Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47967] (4 PDB entries)

8. Domain d1tfba2: 1tfb A:208-316 [18383]
   Other proteins in same PDB: d1tfba3

Details for d1tfba2

PDB Entry: 1tfb

PDB Description: nmr studies of human general transcription factor tfiib: dynamics and interaction with vp16 activation domain, 20 structures

PDB Compounds: (A:) tfiib

SCOPe Domain Sequences for d1tfba2:

Sequence; same for both SEQRES and ATOM records:

>d1tfba2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]}
littgdfmsrfcsnlclpkqvqmaathiarkaveldlvpgrspisvaaaaiymasqasae
krtqkeigdiagvadvtirqsyrliyprapdlfptdfkfdtpvdklpql

Timeline for d1tfba2:

• d1tfba2 first appeared (with stable ids) in SCOP 1.55, called d1tfb_2
  
• d1tfba2 appears in SCOPe 2.07