PDB entry 1tfb

View 1tfb on RCSB PDB site
Description: nmr studies of human general transcription factor tfiib: dynamics and interaction with vp16 activation domain, 20 structures
Class: transcription factor
Keywords: transcription factor, human general transcription factor tfiib, c-terminal core domain, cyclin box fold
Deposited on 1996-11-14, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tfiib
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN TFIIB DELTA 4-111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tfba1, d1tfba2, d1tfba3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfbA (A:)
    masrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiac
    rqegvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqv
    qmaathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqs
    yrliyprapdlfptdfkfdtpvdklpql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfbA (A:)
    srammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacrq
    egvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvqm
    aathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsyr
    liyprapdlfptdfkfdtpvdklpql