Lineage for d3pg9e_ (3pg9 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835534Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2835733Protein automated matches [190083] (10 species)
    not a true protein
  7. 2835848Species Thermotoga maritima [TaxId:2336] [186804] (3 PDB entries)
  8. 2835859Domain d3pg9e_: 3pg9 E: [183709]
    automated match to d1rzma_
    complexed with azi, cl, no3, tyr

Details for d3pg9e_

PDB Entry: 3pg9 (more details), 2.35 Å

PDB Description: Thermotoga maritima DAH7P synthase in complex with inhibitor
PDB Compounds: (E:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d3pg9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pg9e_ c.1.10.4 (E:) automated matches {Thermotoga maritima [TaxId: 2336]}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn

SCOPe Domain Coordinates for d3pg9e_:

Click to download the PDB-style file with coordinates for d3pg9e_.
(The format of our PDB-style files is described here.)

Timeline for d3pg9e_: