Lineage for d1rzma_ (1rzm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835534Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2835535Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 2835608Species Thermotoga maritima [TaxId:2336] [110363] (1 PDB entry)
    Uniprot Q9WYH8
  8. 2835609Domain d1rzma_: 1rzm A: [105137]
    complexed with cd, e4p, pep

Details for d1rzma_

PDB Entry: 1rzm (more details), 2.2 Å

PDB Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHPS) from Thermotoga maritima complexed with Cd2+, PEP and E4P
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d1rzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzma_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn

SCOPe Domain Coordinates for d1rzma_:

Click to download the PDB-style file with coordinates for d1rzma_.
(The format of our PDB-style files is described here.)

Timeline for d1rzma_: