Lineage for d1g3ng1 (1g3n G:16-147)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215344Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 215345Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 215346Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 215424Protein Viral cyclin [47961] (3 species)
  7. 215430Species Kaposi's sarcoma-associated virus [47964] (1 PDB entry)
  8. 215433Domain d1g3ng1: 1g3n G:16-147 [18368]
    Other proteins in same PDB: d1g3na_, d1g3nb_, d1g3ne_, d1g3nf_

Details for d1g3ng1

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3ng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ng1 a.74.1.1 (G:16-147) Viral cyclin {Kaposi's sarcoma-associated virus}
lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
kelleklawrte

SCOP Domain Coordinates for d1g3ng1:

Click to download the PDB-style file with coordinates for d1g3ng1.
(The format of our PDB-style files is described here.)

Timeline for d1g3ng1: