SCOP 1.63: Domain d1g3ne_: 1g3n E:

Lineage for d1g3ne_ (1g3n E:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)

6. Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56115] (47 PDB entries)

8. Domain d1g3ne_: 1g3n E: [41614]
   Other proteins in same PDB: d1g3nb_, d1g3nc1, d1g3nc2, d1g3nf_, d1g3ng1, d1g3ng2

Details for d1g3ne_

PDB Entry: 1g3n, 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3ne_:

Sequence; same for both SEQRES and ATOM records:

>d1g3ne_ d.144.1.1 (E:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq

Timeline for d1g3ne_:

• d1g3ne_ first appeared (with stable ids) in SCOP 1.55
  
• d1g3ne_ appears in SCOP 1.61
  
• d1g3ne_ appears in SCOP 1.65
  
• d1g3ne_ appears in the current release, SCOPe 2.08