SCOPe 2.04: Domain d1bu2a2: 1bu2 A:149-250

Lineage for d1bu2a2 (1bu2 A:149-250)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries)

8. Domain d1bu2a2: 1bu2 A:149-250 [18361]

Details for d1bu2a2

PDB Entry: 1bu2, 3 Å

PDB Description: x-ray structure of a viral cyclin from herpesvirus saimiri

PDB Compounds: (A:) cyclin homolog

SCOPe Domain Sequences for d1bu2a2:

Sequence; same for both SEQRES and ATOM records:

>d1bu2a2 a.74.1.1 (A:149-250) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie
tdntncrpwtcyledlssilnfstntvrtvkdqvseafslyd

Timeline for d1bu2a2:

• d1bu2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1bu2a2 appears in SCOPe 2.03
  
• d1bu2a2 appears in SCOPe 2.05
  
• d1bu2a2 appears in the current release, SCOPe 2.08