![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Viral cyclin [47961] (3 species) |
![]() | Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries) |
![]() | Domain d1bu2a2: 1bu2 A:149-250 [18361] |
PDB Entry: 1bu2 (more details), 3 Å
SCOPe Domain Sequences for d1bu2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bu2a2 a.74.1.1 (A:149-250) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie tdntncrpwtcyledlssilnfstntvrtvkdqvseafslyd
Timeline for d1bu2a2: