| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93061] [189763] (2 PDB entries) |
| Domain d3p7xc_: 3p7x C: [183581] Other proteins in same PDB: d3p7xa2 automated match to d1psqa_ complexed with dtu, dtv, pg4, so4 |
PDB Entry: 3p7x (more details), 1.96 Å
SCOPe Domain Sequences for d3p7xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p7xc_ c.47.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]}
teitfkggpihlkgqqinegdfapdftvldndlnqvtladyagkkklisvvpsidtgvcd
qqtrkfnsdaskeegivltisadlpfaqkrwcasagldnvitlsdhrdlsfgenygvvme
elrllaravfvldadnkvvykeivsegtdfpdfdaalaaykni
Timeline for d3p7xc_:
View in 3DDomains from other chains: (mouse over for more information) d3p7xa1, d3p7xa2, d3p7xb_, d3p7xd_ |