Lineage for d3p5ua_ (3p5u A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634069Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1634391Protein automated matches [190264] (9 species)
    not a true protein
  7. 1634392Species Actinidia arguta [TaxId:64478] [189532] (4 PDB entries)
  8. 1634393Domain d3p5ua_: 3p5u A: [183542]
    automated match to d1aeca_
    complexed with cd

Details for d3p5ua_

PDB Entry: 3p5u (more details), 1.5 Å

PDB Description: Actinidin from Actinidia arguta planch (Sarusashi)
PDB Compounds: (A:) actinidin

SCOPe Domain Sequences for d3p5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5ua_ d.3.1.1 (A:) automated matches {Actinidia arguta [TaxId: 64478]}
lpdyvdwrssgavvdikdqgqcgscwafstiaaveginkiatgdlislseqelvdcgrtq
ntrgcdggfmtdgfqfiinngginteanypytaeegqcnldlqqekyvsidtyenvpynn
ewalqtavayqpvsvaleaagynfqhyssgiftgpcgtavdhavtivgygteggidywiv
knswgttwgeegymriqrnvggvgqcgiakkasypvkyyn

SCOPe Domain Coordinates for d3p5ua_:

Click to download the PDB-style file with coordinates for d3p5ua_.
(The format of our PDB-style files is described here.)

Timeline for d3p5ua_: