Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein automated matches [190264] (9 species) not a true protein |
Species Actinidia arguta [TaxId:64478] [189532] (4 PDB entries) |
Domain d3p5ua_: 3p5u A: [183542] automated match to d1aeca_ complexed with cd |
PDB Entry: 3p5u (more details), 1.5 Å
SCOPe Domain Sequences for d3p5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p5ua_ d.3.1.1 (A:) automated matches {Actinidia arguta [TaxId: 64478]} lpdyvdwrssgavvdikdqgqcgscwafstiaaveginkiatgdlislseqelvdcgrtq ntrgcdggfmtdgfqfiinngginteanypytaeegqcnldlqqekyvsidtyenvpynn ewalqtavayqpvsvaleaagynfqhyssgiftgpcgtavdhavtivgygteggidywiv knswgttwgeegymriqrnvggvgqcgiakkasypvkyyn
Timeline for d3p5ua_: