SCOP 1.63: Domain d1fvvd1: 1fvv D:173-309

Lineage for d1fvvd1 (1fvv D:173-309)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (16 PDB entries)

8. Domain d1fvvd1: 1fvv D:173-309 [18352]
   Other proteins in same PDB: d1fvva_, d1fvvc_

Details for d1fvvd1

PDB Entry: 1fvv, 2.8 Å

PDB Description: the structure of cdk2/cyclin a in complex with an oxindole inhibitor

SCOP Domain Sequences for d1fvvd1:

Sequence; same for both SEQRES and ATOM records:

>d1fvvd1 a.74.1.1 (D:173-309) Cyclin A {Human (Homo sapiens)}
nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
rmehlvlkvltfdlaap

Timeline for d1fvvd1:

• d1fvvd1 first appeared (with stable ids) in SCOP 1.55
  
• d1fvvd1 appears in SCOP 1.61
  
• d1fvvd1 appears in SCOP 1.65
  
• d1fvvd1 appears in the current release, SCOPe 2.08