SCOPe 2.04: Domain d3p52a_: 3p52 A:

Lineage for d3p52a_ (3p52 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (16 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [189531] (1 PDB entry)

8. Domain d3p52a_: 3p52 A: [183508]
   automated match to d1xnga1
   complexed with no3

Details for d3p52a_

PDB Entry: 3p52, 2.74 Å

PDB Description: nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3p52a_:

Sequence, based on SEQRES records:

>d3p52a_ c.26.2.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
amdwqkitekmcdfiqekvknsqsqgvvlglsggidsalvatlckralkenvfallmptq
isnkanledalrlcadlnleykiieiqsildafikqsenttlvslgnfaarirmsllydy
salknslvigtsnkselllgygtiygdlacafnpigslykseiyalakylnlhenfikka
psadlwenqsdeadlgfsytkideglkaletndekllrtldpsliamlknrmqknafkgk
mpeile

Sequence, based on observed residues (ATOM records):

>d3p52a_ c.26.2.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
amdwqkitekmcdfiqekvknsqsqgvvlglsggidsalvatlckralkenvfallmptq
isnkanledalrlcadlnleykiieiqsildafikqsenttlvslgnfaarirmsllydy
salknslvigtsnkselllgygtiygdlacafnpigslykseiyalakylnlhenfikkf
sytkideglkaletndekllrtldpsliamlknrmqknafkgkmpeile

Timeline for d3p52a_:

• d3p52a_ first appeared in SCOPe 2.01
  
• d3p52a_ appears in SCOPe 2.03
  
• d3p52a_ appears in SCOPe 2.05
  
• d3p52a_ appears in the current release, SCOPe 2.08, called d3p52a1