SCOPe 2.08: Domain d3p52a1: 3p52 A:1-245

Lineage for d3p52a1 (3p52 A:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [189531] (1 PDB entry)

8. Domain d3p52a1: 3p52 A:1-245 [183508]
   Other proteins in same PDB: d3p52a2
   automated match to d1xnga1
   complexed with no3

Details for d3p52a1

PDB Entry: 3p52, 2.74 Å

PDB Description: nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3p52a1:

Sequence, based on SEQRES records:

>d3p52a1 c.26.2.0 (A:1-245) automated matches {Campylobacter jejuni [TaxId: 197]}
mdwqkitekmcdfiqekvknsqsqgvvlglsggidsalvatlckralkenvfallmptqi
snkanledalrlcadlnleykiieiqsildafikqsenttlvslgnfaarirmsllydys
alknslvigtsnkselllgygtiygdlacafnpigslykseiyalakylnlhenfikkap
sadlwenqsdeadlgfsytkideglkaletndekllrtldpsliamlknrmqknafkgkm
peile

Sequence, based on observed residues (ATOM records):

>d3p52a1 c.26.2.0 (A:1-245) automated matches {Campylobacter jejuni [TaxId: 197]}
mdwqkitekmcdfiqekvknsqsqgvvlglsggidsalvatlckralkenvfallmptqi
snkanledalrlcadlnleykiieiqsildafikqsenttlvslgnfaarirmsllydys
alknslvigtsnkselllgygtiygdlacafnpigslykseiyalakylnlhenfikkfs
ytkideglkaletndekllrtldpsliamlknrmqknafkgkmpeile

Timeline for d3p52a1:

• d3p52a1 first appeared in SCOPe 2.01, called d3p52a_
  
• d3p52a1 appears in SCOPe 2.07