Lineage for d3p52a1 (3p52 A:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106562Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2106563Protein automated matches [190116] (24 species)
    not a true protein
  7. 2106577Species Campylobacter jejuni [TaxId:197] [189531] (1 PDB entry)
  8. 2106578Domain d3p52a1: 3p52 A:1-245 [183508]
    Other proteins in same PDB: d3p52a2
    automated match to d1xnga1
    complexed with no3

Details for d3p52a1

PDB Entry: 3p52 (more details), 2.74 Å

PDB Description: nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3p52a1:

Sequence, based on SEQRES records: (download)

>d3p52a1 c.26.2.0 (A:1-245) automated matches {Campylobacter jejuni [TaxId: 197]}
mdwqkitekmcdfiqekvknsqsqgvvlglsggidsalvatlckralkenvfallmptqi
snkanledalrlcadlnleykiieiqsildafikqsenttlvslgnfaarirmsllydys
alknslvigtsnkselllgygtiygdlacafnpigslykseiyalakylnlhenfikkap
sadlwenqsdeadlgfsytkideglkaletndekllrtldpsliamlknrmqknafkgkm
peile

Sequence, based on observed residues (ATOM records): (download)

>d3p52a1 c.26.2.0 (A:1-245) automated matches {Campylobacter jejuni [TaxId: 197]}
mdwqkitekmcdfiqekvknsqsqgvvlglsggidsalvatlckralkenvfallmptqi
snkanledalrlcadlnleykiieiqsildafikqsenttlvslgnfaarirmsllydys
alknslvigtsnkselllgygtiygdlacafnpigslykseiyalakylnlhenfikkfs
ytkideglkaletndekllrtldpsliamlknrmqknafkgkmpeile

SCOPe Domain Coordinates for d3p52a1:

Click to download the PDB-style file with coordinates for d3p52a1.
(The format of our PDB-style files is described here.)

Timeline for d3p52a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p52a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3p52b_