Lineage for d1xnga1 (1xng A:3-257)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861350Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 2861377Species Helicobacter pylori [TaxId:210] [142084] (1 PDB entry)
    Uniprot O25096 3-257
  8. 2861378Domain d1xnga1: 1xng A:3-257 [122186]
    Other proteins in same PDB: d1xngb2, d1xngb3
    complexed with atp, dnd, mg
    has additional insertions and/or extensions that are not grouped together

Details for d1xnga1

PDB Entry: 1xng (more details), 1.7 Å

PDB Description: Crystal Structure of NH3-dependent NAD+ synthetase from Helicobacter pylori
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1xnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]}
kdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssv
smpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydys
lksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkpp
sadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriq
knafklelpaiakrf

SCOPe Domain Coordinates for d1xnga1:

Click to download the PDB-style file with coordinates for d1xnga1.
(The format of our PDB-style files is described here.)

Timeline for d1xnga1: