| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
| Protein NH3-dependent NAD+-synthetase [52406] (4 species) |
| Species Helicobacter pylori [TaxId:210] [142084] (1 PDB entry) Uniprot O25096 3-257 |
| Domain d1xnga1: 1xng A:3-257 [122186] Other proteins in same PDB: d1xngb2, d1xngb3 complexed with atp, dnd, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xng (more details), 1.7 Å
SCOPe Domain Sequences for d1xnga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]}
kdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssv
smpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydys
lksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkpp
sadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriq
knafklelpaiakrf
Timeline for d1xnga1: