Lineage for d3p38b_ (3p38 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616045Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 2616046Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 2616047Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 2616052Protein automated matches [190936] (7 species)
    not a true protein
  7. 2616097Species Influenza A virus [TaxId:680789] [189731] (3 PDB entries)
  8. 2616103Domain d3p38b_: 3p38 B: [183484]
    automated match to d2gx9a1
    mutant

Details for d3p38b_

PDB Entry: 3p38 (more details), 2.76 Å

PDB Description: Crystal structure of the NS1 effector domain W182A mutant from influenza A/Vietnam/1203/2004 (H5N1) virus
PDB Compounds: (B:) nonstructural protein 1

SCOPe Domain Sequences for d3p38b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p38b_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 680789]}
pasryltdmtleemsrdwfmlmpkqkvagslcikmdqaimdktiilkanfsvifdrletl
illrafteegaivgeisplpslpghtgedvknaigvliggleandntvrvtetiqrfawr
n

SCOPe Domain Coordinates for d3p38b_:

Click to download the PDB-style file with coordinates for d3p38b_.
(The format of our PDB-style files is described here.)

Timeline for d3p38b_: