| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
| Family c.66.1.1: COMT-like [53336] (4 proteins) |
| Protein automated matches [190251] (3 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (18 PDB entries) |
| Domain d3ozsa_: 3ozs A: [183424] automated match to d1h1da_ protein/RNA complex; complexed with mg, ozs |
PDB Entry: 3ozs (more details), 1.44 Å
SCOPe Domain Sequences for d3ozsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozsa_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp
Timeline for d3ozsa_: